Structure of PDB 8wi7 Chain r

Receptor sequence
>8wi7r (length=94) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
QKGPKYTPAAEKPRGRRKTAIGYVVSDKMQKTIVVELEDRKSHPLYGKII
RTTKKVKAHDENGEAGIGDRVSLMETRPLSATKRWRLVEILEKA
3D structure
PDB8wi7 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chainr
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r K5 K8 Y9 R17 G18 R19 R20 Q33 K44 L48 T56 K60 M77 T79 R80 P81 L82 S83 A84 T85 K86 R87 R89 K2 K5 Y6 R14 G15 R16 R17 Q30 K41 L45 T53 K57 M74 T76 R77 P78 L79 S80 A81 T82 K83 R84 R86
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wi7, PDBe:8wi7, PDBj:8wi7
PDBsum8wi7
PubMed38245551
UniProtA0QSE0|RS17_MYCS2 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]