Structure of PDB 8qsj Chain r

Receptor sequence

>8qsjr (length=146) Species: 9606 (Homo sapiens) [Search protein sequence]

FREVVETTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYDDVLLL
SQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPRQLNRY
LTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH

3D structure

PDB

8qsj Structural insights into the role of GTPBP10 in the RNA maturation of the mitoribosome.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	N82 R94 G98 M99 K120 H123 R124 R132 P133 Y150 L151 R153 W154 A155 S158 Y163 K164 K165 R168 R171 R173 R182 R189 W192 K193 Y195 H196	N43 R55 G59 M60 K81 H84 R85 R93 P94 Y100 L101 R103 W104 A105 S108 Y113 K114 K115 R118 R121 R123 R132 R139 W142 K143 Y145 H146
BS02	FES	r	C70 C73 C108	C31 C34 C69

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8qsj, PDBe:8qsj, PDBj:8qsj
PDBsum	8qsj
PubMed	38042949
UniProt	Q9NVS2\|RT18A_HUMAN Large ribosomal subunit protein mL66 (Gene Name=MRPS18A)