Structure of PDB 8qpp Chain r

Receptor sequence

>8qppr (length=109) Species: 1423 (Bacillus subtilis) [Search protein sequence]

QAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVL
KSAIANAEHNYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTS
HITIVVSEK

3D structure

PDB

8qpp An evolutionarily conserved strategy for ribosome binding and inhibition by beta-coronavirus non-structural protein 1

Chain

Resolution

3.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	K4 A5 V6 A7 R8 R11 R15 K16 R18 R41 A42 K49 S53 A56 E59 H60 F75 D77 E78 P80 K83 R84 R86 P87 R88 A89 M90 G91 A93 S94 Q95 N97 K98 R99 H102	K3 A4 V5 A6 R7 R10 R14 K15 R17 R40 A41 K48 S52 A55 E58 H59 F74 D76 E77 P79 K82 R83 R85 P86 R87 A88 M89 G90 A92 S93 Q94 N96 K97 R98 H101

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links