Structure of PDB 8qpe Chain r

Receptor sequence

>8qper (length=89) Species: 9606 (Homo sapiens)

KRELLRHRDYKVDLESKLGKTIVITKTTPQSEMGGYYCNVCDCVVKDSIN
FLDHINGKKHQRNLGMSMRVERSTLDQVKKRFEVNKKKM

3D structure

• PDB: 8qpe Structural insights into the cross-exon to cross-intron spliceosome switch
• Chain: r
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	K90 D91	K46 D47
BS02	rna	r	H98 G101 K102	H54 G57 K58

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0000398 mRNA splicing, via spliceosome
• GO:0006397 mRNA processing
• GO:0008380 RNA splicing

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005681 spliceosomal complex
• GO:0046540 U4/U6 x U5 tri-snRNP complex
• GO:0071005 U2-type precatalytic spliceosome

External links

• PDB: RCSB:8qpe, PDBe:8qpe, PDBj:8qpe
• PDBsum: 8qpe
• PubMed: 38778104
• UniProt: Q96NC0|ZMAT2_HUMAN Zinc finger matrin-type protein 2 (Gene Name=ZMAT2)