Structure of PDB 8qcq Chain r

Receptor sequence
>8qcqr (length=65) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
KVCYFTSNGITHIDYKDVDLLKKFVSERGKILPRRVTGTNAKYQRKLTAA
IKRARQMALLPYVSG
3D structure
PDB8qcq Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity
Chainr
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r T19 S20 K43 I44 K55 Q57 R58 T61 K65 R66 R68 Q69 Y75 T6 S7 K30 I31 K42 Q44 R45 T48 K52 R53 R55 Q56 Y62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8qcq, PDBe:8qcq, PDBj:8qcq
PDBsum8qcq
PubMed38503735
UniProtP21475|RS18_BACSU Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]