Structure of PDB 8q5i Chain r

Receptor sequence

>8q5ir (length=208) Species: 5476 (Candida albicans) [Search protein sequence]

ARRPARCYRYCKNKPYPKSRYNRAVPDAKIRIYDLGRKKATVDEFPLCIH
LVSNELEQLSSEALEAARICANKYITKVSGRDSFHLRVRVHPFHVLRINK
MQGMRGAWGKPHGLAARVSIGQIIMSARTKDSNKDVVIEGLRRARYKFPG
QQKIIISKKWGFTPLNRDEYIAKKTNGEVIDDGAYVKFLSRKGNLEANLQ
QFPNYQYS

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	R3 R4 A6 R7 K13 N14 K15 Y22 R24 D35 K39 E63 A64 A67 K74 R90 H92 F94 R98 G114 M115 R116 W119 G120 Y157 K158 P160 D193 G194 A195 Y196 K198	R2 R3 A5 R6 K12 N13 K14 Y21 R23 D34 K38 E62 A63 A66 K73 R89 H91 F93 R97 G103 M104 R105 W108 G109 Y146 K147 P149 D182 G183 A184 Y185 K187
BS02	rna	r	Y11 E56 L57 I131 R202 K203 G204 L206 Y216	Y10 E55 L56 I120 R191 K192 G193 L195 Y205

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0009986	cell surface
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	Q5AIB8\|RL10_CANAL Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]