Structure of PDB 8p2g Chain r

Receptor sequence
>8p2gr (length=80) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
RNDRKVYVGKVVSDKMDKTITVLVETYKTHKLYGKRVKYSKKYKTHDENN
SAKLGDIVKIQETRPLSATKRFRLVEIVEE
3D structure
PDB8p2g Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Chainr
Resolution2.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r N5 D6 R7 K8 S16 K18 M19 D20 K21 T22 K31 L35 Y36 K38 R39 K41 Y42 S43 K44 K45 Y46 K47 E65 R67 P68 S70 A71 T72 K73 R74 R76 N2 D3 R4 K5 S13 K15 M16 D17 K18 T19 K28 L32 Y33 K35 R36 K38 Y39 S40 K41 K42 Y43 K44 E62 R64 P65 S67 A68 T69 K70 R71 R73
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2g, PDBe:8p2g, PDBj:8p2g
PDBsum8p2g
PubMed38902339
UniProtQ2FW15|RS17_STAA8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]