Structure of PDB 8p18 Chain r

Receptor sequence

>8p18r (length=115) Species: 562 (Escherichia coli)

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKPI

3D structure

• PDB: 8p18 The compensatory mechanism of a naturally evolved E167K RF2 counteracting the loss of RF1 in bacteria
• Chain: r
• Resolution: 2.77 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	K13 H14 I17 Y23 G24 V25 G26 T28 R29 S76 Y86 R87 R90 H91 P96 V97 R98 Q100 R101 T102 K103 T104 N105 A106 R107 T108 R109 K110 R113 K114 I116	K12 H13 I16 Y22 G23 V24 G25 T27 R28 S75 Y85 R86 R89 H90 P95 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 R112 K113 I115
BS02	rna	r	M81 R92	M80 R91

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p18, PDBe:8p18, PDBj:8p18
• PDBsum: 8p18
• UniProt: P0A7S9|RS13_ECOLI Small ribosomal subunit protein uS13 (Gene Name=rpsM)