Structure of PDB 8k5o Chain r

Receptor sequence

>8k5or (length=62) Species: 1052 (Halorhodospira halochloris) [Search protein sequence]

IRTGLTDEECQEIHEMNMLGMHAYWSIGLIANALAYAWRPFHQGRAGNRL
EDHAPDYVRSAL

3D structure

PDB

8k5o Structural insights into the unusual core photocomplex from a triply extremophilic purple bacterium, Halorhodospira halochloris.

Chain

Resolution

2.42 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	r	Q14 H17 E18 L22 H25 A26 S29 L32 I33 A36 Y39 A40 P43	Q11 H14 E15 L19 H22 A23 S26 L29 I30 A33 Y36 A37 P40
BS02	A1LZM	r	A34 A38 W41	A31 A35 W38
BS03	A1LZM	r	Y27 G31 A34 N35 W41	Y24 G28 A31 N32 W38
BS04	A1LZM	r	M19 N20 M24 Y27 W28	M16 N17 M21 Y24 W25
BS05	A1LZM	r	Y27 W28 G31 L32 N35 F44 H45	Y24 W25 G28 L29 N32 F41 H42
BS06	A1LZQ	r	H17 M21 M24 H25 W28	H14 M18 M21 H22 W25

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0046872	metal ion binding

External links