Structure of PDB 8ipx Chain r

Receptor sequence
>8ipxr (length=82) Species: 9606 (Homo sapiens) [Search protein sequence]
IPKGKPKSGRVWKDRSKKRFSQMLQDKPLRTSWQRKMKERQERKLAKDFA
RHLEEEKERRRQEKKQRRAENLKRRLENERKA
3D structure
PDB8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.
Chainr
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r K237 G238 K241 S242 R244 W246 K247 K251 K252 R253 F254 L263 R264 W267 K270 R274 K299 R302 A303 L306 K3 G4 K7 S8 R10 W12 K13 K17 K18 R19 F20 L29 R30 W33 K36 R40 K65 R68 A69 L72
BS02 rna r R302 E313 R68 E79
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
PDBsum8ipx
PubMed37491604
UniProtQ9H6F5|CCD86_HUMAN Coiled-coil domain-containing protein 86 (Gene Name=CCDC86)

[Back to BioLiP]