Structure of PDB 8cg8 Chain r

Receptor sequence
>8cg8r (length=91) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
SYRGVDFVKLAPARVRRRFMKKLRAAKLAAPENEKPAPVRTHMRNMIIVP
EMIGSVVGIYNGKAFNQVEIRPEMLGHYLGEFSITYTPVRH
3D structure
PDB8cg8 Cryo-EM analysis of eukaryotic ribosome translocation intermediates
Chainr
Resolution2.57 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r P38 A39 R40 R42 R43 R44 R77 T78 H79 R81 N82 Y97 N98 G99 K100 Y115 E118 T122 Y123 T124 V126 H128 P12 A13 R14 R16 R17 R18 R40 T41 H42 R44 N45 Y60 N61 G62 K63 Y78 E81 T85 Y86 T87 V89 H91
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cg8, PDBe:8cg8, PDBj:8cg8
PDBsum8cg8
PubMed38030725
UniProtQ01855|RS15_YEAST Small ribosomal subunit protein uS19 (Gene Name=RPS15)

[Back to BioLiP]