Structure of PDB 8c6j Chain r

Receptor sequence

>8c6jr (length=73) Species: 9606 (Homo sapiens) [Search protein sequence]

AHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQ
QNNIGMVVIRGNSIIMLEALERV

3D structure

PDB

8c6j Regulation of 3' splice site selection after step 1 of splicing by spliceosomal C* proteins.

Chain

Resolution

2.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	F37 M38 R63 G64	F34 M35 R60 G61

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005683	U7 snRNP
GO:0005684	U2-type spliceosomal complex
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005689	U12-type spliceosomal complex
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0030532	small nuclear ribonucleoprotein complex
GO:0034709	methylosome
GO:0034719	SMN-Sm protein complex
GO:0043186	P granule
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071004	U2-type prespliceosome
GO:0071005	U2-type precatalytic spliceosome
GO:0071007	U2-type catalytic step 2 spliceosome
GO:0071011	precatalytic spliceosome
GO:0071013	catalytic step 2 spliceosome
GO:0097526	spliceosomal tri-snRNP complex

External links

PDB	RCSB:8c6j, PDBe:8c6j, PDBj:8c6j
PDBsum	8c6j
PubMed	36867703
UniProt	P62308\|RUXG_HUMAN Small nuclear ribonucleoprotein G (Gene Name=SNRPG)