Structure of PDB 8any Chain r

Receptor sequence

>8anyr (length=162) Species: 9606 (Homo sapiens) [Search protein sequence]

FREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYD
DVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPR
LPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDN
VCYSRTPWKLYH

3D structure

PDB

8any Structural basis of LRPPRC-SLIRP-dependent translation by the mitoribosome

Chain

Resolution

2.85 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	N82 R94 H96 G98 M99 P101 R102 K103 H112 E116 K120 H123 R124 R132 P133 K142 K144 Y150 L151 W154 A155 S158 K160 Y163 K165 G166 R168 R171 R173 R182 S188 R189 W192 K193 Y195 H196	N48 R60 H62 G64 M65 P67 R68 K69 H78 E82 K86 H89 R90 R98 P99 K108 K110 Y116 L117 W120 A121 S124 K126 Y129 K131 G132 R134 R137 R139 R148 S154 R155 W158 K159 Y161 H162
BS02	FES	r	C70 C73 C108 E111	C36 C39 C74 E77

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8any, PDBe:8any, PDBj:8any
PDBsum	8any
PubMed	39134711
UniProt	Q9NVS2\|RT18A_HUMAN Large ribosomal subunit protein mL66 (Gene Name=MRPS18A)

[Back to BioLiP]