Structure of PDB 8aaf Chain r

Receptor sequence

>8aafr (length=218) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MLSCAGADRLQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEG
LRRARYKFPGQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLS
KKGSLENNIREFPEYFAA

3D structure

• PDB: 8aaf Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.
• Chain: r
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	R3 R4 A6 R7 K13 N14 K15 Y17 Y22 Y34 D35 K39 K40 E63 A64 A67 R90 H92 F94 R98 G107 D109 R110 Q112 Q113 M115 R116 W119 Q133 R154 Y157 K158 P160 D193 G194 F196 K198	R2 R3 A5 R6 K12 N13 K14 Y16 Y21 Y33 D34 K38 K39 E62 A63 A66 R89 H91 F93 R97 G106 D108 R109 Q111 Q112 M114 R115 W118 Q132 R153 Y156 K157 P159 D192 G193 F195 K197
BS02	rna	r	Y11 E56 K202 K203 G204 L206 N209	Y10 E55 K201 K202 G203 L205 N208
BS03	rna	r	C105 A106	C104 A105

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8aaf, PDBe:8aaf, PDBj:8aaf
• PDBsum: 8aaf
• PubMed: 36804914
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)