Structure of PDB 7ucj Chain r

Receptor sequence
>7ucjr (length=124) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
SAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGV
EPAADGKGVVVVMKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNK
YHPDLRMAAIRRASAILRSQKPVM
3D structure
PDB7ucj Direct epitranscriptomic regulation of mammalian translation initiation through N4-acetylcytidine.
Chainr
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r W7 R11 S15 K19 K22 R35 N36 S37 F38 R46 R66 R67 Q70 N85 R87 S92 H95 M96 R98 K99 N100 K101 R107 M108 R112 W6 R10 S14 K18 K21 R34 N35 S36 F37 R45 R65 R66 Q69 N84 R86 S91 H94 M95 R97 K98 N99 K100 R106 M107 R111
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ucj, PDBe:7ucj, PDBj:7ucj
PDBsum7ucj
PubMed35679869
UniProtG1U7L1|RL28_RABIT Large ribosomal subunit protein eL28 (Gene Name=RPL28)

[Back to BioLiP]