Structure of PDB 7sfr Chain r

Receptor sequence
>7sfrr (length=63) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
CVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAVK
NAREVALLPFTSS
3D structure
PDB7sfr Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
Chainr
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r K26 K47 I48 R51 Q59 R62 K69 N70 R72 E73 F79 K7 K28 I29 R32 Q40 R43 K50 N51 R53 E54 F60
BS02 ZN r C20 C23 C57 H60 C1 C4 C38 H41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sfr, PDBe:7sfr, PDBj:7sfr
PDBsum7sfr
PubMed36827973
UniProtP9WH49|RS181_MYCTU Small ribosomal subunit protein bS18A (Gene Name=rpsR1)

[Back to BioLiP]