Structure of PDB 7ryf Chain r

Receptor sequence

>7ryfr (length=52) Species: 480119 (Acinetobacter baumannii AB0057)

IDYKDIDTLKQYITENGKIVPSRITGTKARYQRQLALAIKQARYLSLIPY
TD

3D structure

• PDB: 7ryf An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
• Chain: r
• Resolution: 2.65 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	K38 I39 S42 Q52 R53 K60 R63 Y64 Y70	K18 I19 S22 Q32 R33 K40 R43 Y44 Y50

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat Nov 16 02:51:29 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7ryf', asym_id = 'r', title = 'An Analysis of the Novel Fluorocycline TP-6076 B...g Efflux Pump AdeJ from Acinetobacter baumannii. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7ryf', asym_id='r', title='An Analysis of the Novel Fluorocycline TP-6076 B...g Efflux Pump AdeJ from Acinetobacter baumannii. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7ryf', asym_id = 'r'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7ryf', asym_id='r')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>