Structure of PDB 7qwr Chain r

Receptor sequence
>7qwrr (length=125) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]
SAHLQWMVVRNCSSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGV
EPAADGKGVVVVMKRRSGQRKPATSYVRTTINKNARATLSSIRHMIRKNK
YHPDLRMAAIRRASAILRSQKPVMV
3D structure
PDB7qwr Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
Chainr
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r W7 R11 K19 R20 K22 T24 N36 S37 F38 R39 R46 R66 R67 S68 K84 N85 R87 S92 R94 H95 M96 R98 K99 N100 K101 D105 R107 M108 R112 W6 R10 K18 R19 K21 T23 N35 S36 F37 R38 R45 R65 R66 S67 K83 N84 R86 S91 R93 H94 M95 R97 K98 N99 K100 D104 R106 M107 R111
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qwr, PDBe:7qwr, PDBj:7qwr
PDBsum7qwr
PubMed35201867
UniProtG1U7L1|RL28_RABIT Large ribosomal subunit protein eL28 (Gene Name=RPL28)

[Back to BioLiP]