Structure of PDB 7qi5 Chain r

Receptor sequence

>7qi5r (length=162) Species: 9606 (Homo sapiens)

FREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYD
DVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPR
LPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDN
VCYSRTPWKLYH

3D structure

• PDB: 7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
• Chain: r
• Resolution: 2.63 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	N82 R94 H96 G98 M99 P101 R102 H112 E116 K120 H123 R124 R132 P133 K142 K144 Y150 L151 W154 A155 S158 K160 Y163 K165 G166 R168 R171 R173 R182 S188 R189 W192 K193 Y195 H196	N48 R60 H62 G64 M65 P67 R68 H78 E82 K86 H89 R90 R98 P99 K108 K110 Y116 L117 W120 A121 S124 K126 Y129 K131 G132 R134 R137 R139 R148 S154 R155 W158 K159 Y161 H162
BS02	FES	r	Q69 C70 C73 K78 C108 E111	Q35 C36 C39 K44 C74 E77

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0070181 small ribosomal subunit rRNA binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
• PDBsum: 7qi5
• PubMed: 38769321
• UniProt: Q9NVS2|RT18A_HUMAN Large ribosomal subunit protein mL66 (Gene Name=MRPS18A)