Structure of PDB 7qh7 Chain r

Receptor sequence

>7qh7r (length=129) Species: 9606 (Homo sapiens)

PKESPNPPNPSGQCPICRWNLKHKYNYDDVLLLSQFIRPHGGMLPRKITG
LCQEEHRKIEECVKMAHRAGLLPNHRPRQLNRYLTRWAPGSVKPIYKKGP
RWNRVRMPVGSPLLRDNVCYSRTPWKLYH

3D structure

• PDB: 7qh7 A late-stage assembly checkpoint of the human mitochondrial ribosome large subunit.
• Chain: r
• Resolution: 2.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	N82 R94 M99 P101 R102 H112 E116 H123 R124 P133 Y150 L151 W154 A155 S158 Y163 K165 G166 R168 R171 R173 N184 Y187 R189 W192 K193 H196	N26 R38 M43 P45 R46 H56 E60 H67 R68 P77 Y83 L84 W87 A88 S91 Y96 K98 G99 R101 R104 R106 N117 Y120 R122 W125 K126 H129
BS02	ZN	r	C70 C108	C14 C52

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:7qh7, PDBe:7qh7, PDBj:7qh7
• PDBsum: 7qh7
• PubMed: 35177605
• UniProt: Q9NVS2|RT18A_HUMAN Large ribosomal subunit protein mL66 (Gene Name=MRPS18A)