Structure of PDB 7q0f Chain r

Receptor sequence

>7q0fr (length=208) Species: 237561 (Candida albicans SC5314) [Search protein sequence]

ARRPARCYRYCKNKPYPKSRYNRAVPDAKIRIYDLGRKKATVDEFPLCIH
LVSNELEQLSSEALEAARICANKYITKVSGRDSFHLRVRVHPFHVLRINK
MQGMRGAWGKPHGLAARVSIGQIIMSARTKDSNKDVVIEGLRRARYKFPG
QQKIIISKKWGFTPLNRDEYIAKKTNGEVIDDGAYVKFLSRKGNLEANLQ
QFPNYQYS

3D structure

PDB

7q0f E-site drug specificity of the human pathogen Candida albicans ribosome.

Chain

Resolution

2.64 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	R3 R4 A6 R7 K13 N14 K15 R21 Y22 D35 K39 S61 E63 A64 K74 R90 H92 F94 R98 N100 G114 M115 R116 W119 G120 R154 Y157 K158 P160 D193 A195 Y196 K198	R2 R3 A5 R6 K12 N13 K14 R20 Y21 D34 K38 S60 E62 A63 K73 R89 H91 F93 R97 N99 G103 M104 R105 W108 G109 R143 Y146 K147 P149 D182 A184 Y185 K187
BS02	rna	r	Y11 E56 I131 R202 K203 G204 L206	Y10 E55 I120 R191 K192 G193 L195

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0009986	cell surface
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q0f, PDBe:7q0f, PDBj:7q0f
PDBsum	7q0f
PubMed	35613268
UniProt	Q5AIB8\|RL10_CANAL Large ribosomal subunit protein uL16 (Gene Name=RPL10)

[Back to BioLiP]