Structure of PDB 7pat Chain r

Receptor sequence

>7patr (length=139) Species: 272634 (Mycoplasmoides pneumoniae M129)

MIAFAKQFRVRISPQKARLVCQLIVGKKTADAQNILSNTPKKAATLIAKL
LNSAIANATNNHGMNGDALYVFECVANQGPSMKRTIPRAKGSSNMITKRS
SNLVVKLSDNPNERQELIKQQKALVKKRVEGQQKAKMAR

3D structure

• PDB: 7pat Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: r
• Resolution: 9.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	F4 A5 K6 F8 R11 Q15 K16 P40 K41 K42 K49 N52 A56 N57 N60 N61 H62 E73 N77 Q78 R84 T85 I86 P87 R88 A89 K90 G91 S93 M95 I96 T97 K98 R99 R114 Q121 K126 K127 R128 V129 G131 Q132 Q133	F4 A5 K6 F8 R11 Q15 K16 P40 K41 K42 K49 N52 A56 N57 N60 N61 H62 E73 N77 Q78 R84 T85 I86 P87 R88 A89 K90 G91 S93 M95 I96 T97 K98 R99 R114 Q121 K126 K127 R128 V129 G131 Q132 Q133

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pat, PDBe:7pat, PDBj:7pat
• PDBsum: 7pat
• PubMed: 36171285
• UniProt: P75575|RL22_MYCPN Large ribosomal subunit protein uL22 (Gene Name=rplV)