Structure of PDB 7oii Chain r

Receptor sequence
>7oiir (length=100) Species: 562 (Escherichia coli) [Search protein sequence]
AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTL
PRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
3D structure
PDB7oii A switch from alpha-helical to beta-strand conformation during co-translational protein folding.
Chainr
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r K3 Q4 S5 M6 R9 R13 F21 R24 K28 R53 S56 S58 R59 R61 R63 R69 H71 G72 R75 R85 S100 W101 K2 Q3 S4 M5 R8 R12 F20 R23 K27 R52 S55 S57 R58 R60 R62 R68 H70 G71 R74 R84 S99 W100
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Mon Nov 18 00:44:00 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7oii', asym_id = 'r', title = 'A switch from alpha-helical to beta-strand conformation during co-translational protein folding.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7oii', asym_id='r', title='A switch from alpha-helical to beta-strand conformation during co-translational protein folding.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '7oii', asym_id = 'r'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='7oii', asym_id='r')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>