Structure of PDB 7of6 Chain r

Receptor sequence

>7of6r (length=157) Species: 9606 (Homo sapiens) [Search protein sequence]

FREVVETQEGKTTIIEGRITATPKESPNPPNPSGQCPICRWNLKHKYNYD
DVLLLSQFIRPHGGMLPRKITGLCQEEHRKIEECVKMAHRAGLLPNHRPR
LPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSR
TPWKLYH

3D structure

PDB

7of6 Structural basis of GTPase-mediated mitochondrial ribosome biogenesis and recycling.

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	N82 R94 H96 G98 M99 P101 R102 H112 E116 K120 H123 R124 R132 P133 P141 K142 K144 Y150 L151 R153 W154 A155 S158 K160 Y163 K165 R168 R171 R173 R182 R189 W192 K193 Y195 H196	N48 R60 H62 G64 M65 P67 R68 H78 E82 K86 H89 R90 R98 P99 P102 K103 K105 Y111 L112 R114 W115 A116 S119 K121 Y124 K126 R129 R132 R134 R143 R150 W153 K154 Y156 H157
BS02	ZN	r	C70 C73 C108	C36 C39 C74

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7of6, PDBe:7of6, PDBj:7of6
PDBsum	7of6
PubMed	34135319
UniProt	Q9NVS2\|RT18A_HUMAN Large ribosomal subunit protein mL66 (Gene Name=MRPS18A)

[Back to BioLiP]