Structure of PDB 7mt7 Chain r

Receptor sequence
>7mt7r (length=64) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
KCVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAV
KNAREVALLPFTSS
3D structure
PDB7mt7 Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chainr
Resolution2.71 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r K19 C23 A24 K26 K47 I48 R49 A50 R51 V58 Q59 R62 K69 N70 R72 E73 F79 K1 C5 A6 K8 K29 I30 R31 A32 R33 V40 Q41 R44 K51 N52 R54 E55 F61
BS02 ZN r C57 H60 C39 H42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7mt7, PDBe:7mt7, PDBj:7mt7
PDBsum7mt7
PubMed35064151
UniProtP9WH49|RS181_MYCTU Small ribosomal subunit protein bS18A (Gene Name=rpsR1)

[Back to BioLiP]