Structure of PDB 7msh Chain r

Receptor sequence
>7mshr (length=64) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence]
KCVFCAKKDQAIDYKDTALLRTYISERGKIRARRVTGNCVQHQRDIALAV
KNAREVALLPFTSS
3D structure
PDB7msh Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
Chainr
Resolution3.23 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna r K19 K26 K47 I48 R49 R51 V58 Q59 R62 K69 N70 R72 E73 F79 K1 K8 K29 I30 R31 R33 V40 Q41 R44 K51 N52 R54 E55 F61
BS02 ZN r C57 H60 C39 H42
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7msh, PDBe:7msh, PDBj:7msh
PDBsum7msh
PubMed35064151
UniProtP9WH49|RS181_MYCTU Small ribosomal subunit protein bS18A (Gene Name=rpsR1)

[Back to BioLiP]