Structure of PDB 6ypu Chain r

Receptor sequence
>6ypur (length=79) Species: 575584 (Acinetobacter baumannii ATCC 19606 = CIP 70.34 = JCM 6841) [Search protein sequence]
TVRTLTGKVVSDKMDKSIVVLIERRVQHPLYGKSIRRSTKLHAHDENNVA
KIGDVVTIKESRPISKTKAWTLVEVVEAA
3D structure
PDB6ypu Structure of the 70S Ribosome from the Human Pathogen Acinetobacter baumannii in Complex with Clinically Relevant Antibiotics.
Chainr
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r R7 M18 L34 Y35 K37 R40 R41 S42 T43 K44 H46 E64 R66 P67 I68 S69 K70 K72 R3 M14 L30 Y31 K33 R36 R37 S38 T39 K40 H42 E60 R62 P63 I64 S65 K66 K68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ypu, PDBe:6ypu, PDBj:6ypu
PDBsum6ypu
PubMed32857965
UniProtD0CD06

[Back to BioLiP]