Structure of PDB 6hhq Chain r

Receptor sequence

>6hhqr (length=211) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
MQQGMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFP
GQQKIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNI
REFPEYFAAQA

3D structure

• PDB: 6hhq Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
• Chain: r
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	r	R3 R4 A6 R7 C8 K13 N14 K15 P16 P18 Y22 R24 Y34 K39 S61 A64 A67 R90 H92 F94 R98 I99 M115 R116 G117 A118 W119 Y157 K158 P160 D193 G194 K198	R2 R3 A5 R6 C7 K12 N13 K14 P15 P17 Y21 R23 Y33 K38 S60 A63 A66 R89 H91 F93 R97 I98 M105 R106 G107 A108 W109 Y147 K148 P150 D183 G184 K188
BS02	rna	r	Y11 E56 L57 I131 K202 K203 G204 L206	Y10 E55 L56 I121 K192 K193 G194 L196
BS03	MG	r	R156 Q163	R146 Q153

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6hhq, PDBe:6hhq, PDBj:6hhq
• PDBsum: 6hhq
• PubMed: 30759226
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)