Structure of PDB 6enf Chain r

Receptor sequence
>6enfr (length=65) Species: 562 (Escherichia coli) [Search protein sequence]
FCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAI
KRARYLSLLPYTDRH
3D structure
PDB6enf Structural Basis for Polyproline-Mediated Ribosome Stalling and Rescue by the Translation Elongation Factor EF-P.
Chainr
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r K37 I38 P40 S41 K49 Q51 R52 R56 K59 R60 R62 Y69 R72 H73 K29 I30 P32 S33 K41 Q43 R44 R48 K51 R52 R54 Y61 R64 H65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6enf, PDBe:6enf, PDBj:6enf
PDBsum6enf
PubMed29100052
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]