Structure of PDB 6ah0 Chain r

Receptor sequence
>6ah0r (length=75) Species: 9606 (Homo sapiens) [Search protein sequence]
EPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIE
IYKSTKRNIPMLFVRGDGVVLVAPP
3D structure
PDB6ah0 Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
Chainr
Resolution5.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r G89 D90 G66 D67
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0030629 U6 snRNA 3'-end binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0033962 P-body assembly
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005688 U6 snRNP
GO:0005829 cytosol
GO:0032991 protein-containing complex
GO:0046540 U4/U6 x U5 tri-snRNP complex
GO:0071005 U2-type precatalytic spliceosome
GO:0071011 precatalytic spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0120115 Lsm2-8 complex
GO:1990726 Lsm1-7-Pat1 complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ah0, PDBe:6ah0, PDBj:6ah0
PDBsum6ah0
PubMed30315277
UniProtP62310|LSM3_HUMAN U6 snRNA-associated Sm-like protein LSm3 (Gene Name=LSM3)

[Back to BioLiP]