Structure of PDB 5uq7 Chain r

Receptor sequence
>5uq7r (length=68) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
AKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKT
IKRARILGLLPFTEKLVR
3D structure
PDB5uq7 Alternative Mode of E-Site tRNA Binding in the Presence of a Downstream mRNA Stem Loop at the Entrance Channel.
Chainr
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r K49 I50 P52 R53 R54 R55 A60 K61 Q63 R64 K68 K71 R72 R74 I75 F81 K30 I31 P33 R34 R35 R36 A41 K42 Q44 R45 K49 K52 R53 R55 I56 F62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5uq7, PDBe:5uq7, PDBj:5uq7
PDBsum5uq7
PubMed29456023
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]