Structure of PDB 5l3p Chain r

Receptor sequence
>5l3pr (length=65) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
FCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRITGTRAKYQRQLARAI
KRARYLSLLPYTDRH
3D structure
PDB5l3p The stringent factor RelA adopts an open conformation on the ribosome to stimulate ppGpp synthesis.
Chainr
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r C10 K37 I38 P40 S41 K49 R52 R56 K59 R60 Y69 H73 C2 K29 I30 P32 S33 K41 R44 R48 K51 R52 Y61 H65
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5l3p, PDBe:5l3p, PDBj:5l3p
PDBsum5l3p
PubMed27226493
UniProtP0A7T7|RS18_ECOLI Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]