Structure of PDB 4w2e Chain r

Receptor sequence
>4w2er (length=68) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
AKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKT
IKRARILGLLPFTEKLVR
3D structure
PDB4w2e Crystal structure of elongation factor 4 bound to a clockwise ratcheted ribosome.
Chainr
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r K49 I50 K61 Q63 R64 K68 K71 R74 I75 F81 K30 I31 K42 Q44 R45 K49 K52 R55 I56 F62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w2e, PDBe:4w2e, PDBj:4w2e
PDBsum4w2e
PubMed25104389
UniProtQ5SLQ0|RS18_THET8 Small ribosomal subunit protein bS18 (Gene Name=rpsR)

[Back to BioLiP]