Structure of PDB 4v4j Chain r

Receptor sequence
>4v4jr (length=104) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKY
KLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKR
GGKA
3D structure
PDB4v4j Interactions and dynamics of the Shine Dalgarno helix in the 70S ribosome.
Chainr
Resolution3.83 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna r P2 K3 T18 R25 L31 Y32 K34 K37 S39 K40 E61 R63 P64 I65 S66 K67 R68 R70 R91 Y95 L98 S99 K100 R101 G102 A105 P1 K2 T17 R24 L30 Y31 K33 K36 S38 K39 E60 R62 P63 I64 S65 K66 R67 R69 R90 Y94 L97 S98 K99 R100 G101 A104
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v4j, PDBe:4v4j, PDBj:4v4j
PDBsum4v4j
PubMed17940016
UniProtP0DOY7|RS17_THET8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]