Structure of PDB 4u3n Chain q3

Receptor sequence

>4u3nq3 (length=91) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

AKRTKKVGITGKYGVRYGSSLRRQVKKLEIQQHARYDCSFCGKKTVKRGA
AGIWTCSCCKKTVAGGAYTVSTAAAATVRSTIRRLREMVEA

3D structure

PDB

4u3n ?

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	q3	R24 K28 R85	R23 K27 R84
BS02	rna	q3	A2 R4 T5 K6 K7 V8 G9 I10 G12 K13 Y14 G15 V16 R17 Y18 G19 S20 S21 L22 R23 Q33 H34 R36 C42 K44 R49 A51 K62	A1 R3 T4 K5 K6 V7 G8 I9 G11 K12 Y13 G14 V15 R16 Y17 G18 S19 S20 L21 R22 Q32 H33 R35 C41 K43 R48 A50 K61
BS03	ZN	q3	C39 C42 C57 C60	C38 C41 C56 C59

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0046872	metal ion binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4u3n, PDBe:4u3n, PDBj:4u3n
PDBsum	4u3n
PubMed	25209664
UniProt	P0CX25\|RL43A_YEAST Large ribosomal subunit protein eL43A (Gene Name=RPL43A)