Structure of PDB 7r81 Chain q1

Receptor sequence

>7r81q1 (length=105) Species: 5141 (Neurospora crassa) [Search protein sequence]

VNVPKTRKTYCAGRSCGKHTLHKVTQYKAGKASAFAQGKRRYDRKQSGYG
GQTKPVFHKKAKTTKKVVLRLECSVCKQKKQLPLKRCKHFELGGDKKTKG
AALVF

3D structure

PDB

7r81 Structure of the translating Neurospora ribosome arrested by cycloheximide

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	q1	V2 N3 P5 R8 K9 Y11 R15 K19 H20 Y28 G31 S34 F36 A37 Q38 G39 R41 R42 R45 K46 G49 Y50 G52 Q53 T54 K55 P56 V57 F58 H59 K60 K61 A62 K63 T65 K67 V69 Q79 K80 Q82 K86 C88 K89 K97 K98 K100	V1 N2 P4 R7 K8 Y10 R14 K18 H19 Y27 G30 S33 F35 A36 Q37 G38 R40 R41 R44 K45 G48 Y49 G51 Q52 T53 K54 P55 V56 F57 H58 K59 K60 A61 K62 T64 K66 V68 Q78 K79 Q81 K85 C87 K88 K96 K97 K99
BS02	rna	q1	L104 F106	L103 F105

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links