Structure of PDB 5tga Chain q0

Receptor sequence
>5tgaq0 (length=52) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
IIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQLRPKKK
LK
3D structure
PDB5tga Molecular insights into protein synthesis with proline residues.
Chainq0
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q0 R97 Y100 R102 P104 N109 R111 K112 R113 K114 G116 N119 R122 K124 K125 R21 Y24 R26 P28 N33 R35 K36 R37 K38 G40 N43 R46 K48 K49
BS02 ZN q0 C96 C99 C110 C20 C23 C34
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5tga, PDBe:5tga, PDBj:5tga
PDBsum5tga
PubMed27827794
UniProtP0CH08|RL40A_YEAST Ubiquitin-ribosomal protein eL40A fusion protein (Gene Name=RPL40A)

[Back to BioLiP]