Structure of PDB 8wib Chain q

Receptor sequence
>8wibq (length=113) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]
AVKIKLTRLGKIRNPQYRIIVADARTRRDGRAIEVIGRYHPKEEPSLIQI
DSERAQYWLGVGAQPTEPVLALLKITGDWQKFKGLPGAEGTLKVKEPKPS
KLDLFNAALAEAE
3D structure
PDB8wib Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
Chainq
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q A2 K4 K6 G11 K12 I13 R14 Q17 R19 D24 R26 R28 R29 R32 P46 S47 I49 G63 Q65 T67 P69 I76 K94 A1 K3 K5 G10 K11 I12 R13 Q16 R18 D23 R25 R27 R28 R31 P45 S46 I48 G62 Q64 T66 P68 I75 K93
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8wib, PDBe:8wib, PDBj:8wib
PDBsum8wib
PubMed38245551
UniProtA0QV37|RS16_MYCS2 Small ribosomal subunit protein bS16 (Gene Name=rpsP)

[Back to BioLiP]