Structure of PDB 8qcq Chain q

Receptor sequence

>8qcqq (length=85) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

SERNQRKVYQGRVVSDKMDKTITVVVETYKKHTLYGKRVKYSKKFKAHDE
NNQAKIGDIVKIMETRPLSATKRFRLVEVVEEAVI

3D structure

PDB

8qcq Novel arrest peptides induce ribosome stalling by short circuiting the ribosomal peptidyltransferase activity

Chain

Resolution

2.3 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	q	S2 R4 N5 Q6 R7 K8 Y10 S16 K18 M19 D20 K21 T22 K31 K32 L35 Y36 K38 R39 K41 Y42 S43 K44 K45 F46 K47 E65 T66 R67 P68 S70 A71 T72 K73 R74 R76	S1 R3 N4 Q5 R6 K7 Y9 S15 K17 M18 D19 K20 T21 K30 K31 L34 Y35 K37 R38 K40 Y41 S42 K43 K44 F45 K46 E64 T65 R66 P67 S69 A70 T71 K72 R73 R75

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8qcq, PDBe:8qcq, PDBj:8qcq
PDBsum	8qcq
PubMed	38503735
UniProt	P12874\|RS17_BACSU Small ribosomal subunit protein uS17 (Gene Name=rpsQ)