Structure of PDB 8p2g Chain q

Receptor sequence

>8p2gq (length=90) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325)

AVKIRLTRLGSKRNPFYRIVVADARSPRDGRIIEQIGTYNPTSANAPEIK
VDEALALKWLNDGAKPTDTVHNILSKEGIMKKFDEQKKAK

3D structure

• PDB: 8p2g Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
• Chain: q
• Resolution: 2.02 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	q	A2 V3 K4 R6 L7 R9 L10 G11 S12 K13 R14 F17 Y18 R19 A25 R26 P28 R29 G31 R32 I34 T43 W60 D63 G64 K66 T68 D69 T70 H72 N73 S76 K77 M81 K82 D85 K89	A1 V2 K3 R5 L6 R8 L9 G10 S11 K12 R13 F16 Y17 R18 A24 R25 P27 R28 G30 R31 I33 T42 W59 D62 G63 K65 T67 D68 T69 H71 N72 S75 K76 M80 K81 D84 K88

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p2g, PDBe:8p2g, PDBj:8p2g
• PDBsum: 8p2g
• PubMed: 38902339
• UniProt: Q2FZ45|RS16_STAA8 Small ribosomal subunit protein bS16 (Gene Name=rpsP)