Structure of PDB 8ipx Chain q

Receptor sequence

>8ipxq (length=404) Species: 9606 (Homo sapiens) [Search protein sequence]

MGGLEKKKYERGSATNYITRNKARKKLQLSLADFRRLCILKGIYPHEPKH
KKKVNKGSTAARTFYLIKDIRFLLHEPIVNKFREYKVFVRKLRKAYGKSE
WNTVERLKDNKPNYKLDHIIKERYPTFIDALRDLDDALSMCFLFSTFPRT
GKCHVQTIQLCRRLTVEFMHYIIAARALRKVFLSIKGIYYQAEVLGQPIV
WITPYAFSHDHPTDVDYRVMATFTEFYTTLLGFVNFRLYQLLNLHYPPKL
EGQAQLDSESCMEKLAALSASLARVVVDGEMSAQEEDRRKELEAQEKHKK
LFEGLKFFLNREVPREALAFIIRSFGGEVSWDKSLCIGATYDVTDSRITH
QIVDRPGQQTSVIGRCYVQPQWVFDSVNARLLLPVAEYFSGVQLPPHLSP
FVTE

3D structure

PDB

8ipx Visualizing the nucleoplasmic maturation of human pre-60S ribosomal particles.

Chain

Resolution

4.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	q	M1 G2 E5 K6 K7 K8 R11 G12 S13 R20 N21 K22 R24 K25 L31 R35 K49 H50 K52 K53 G57 S58 T59 A60 R62 R93 K94 Y96 K98 R106 K108 R149 G151 H154 V155 D214 V215 D216	M1 G2 E5 K6 K7 K8 R11 G12 S13 R20 N21 K22 R24 K25 L31 R35 K49 H50 K52 K53 G57 S58 T59 A60 R62 R93 K94 Y96 K98 R106 K108 R149 G151 H154 V155 D214 V215 D216
BS02	rna	q	K68 R71 H75 R90	K68 R71 H75 R90

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0043021	ribonucleoprotein complex binding

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000466	maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364	rRNA processing
GO:0008283	cell population proliferation
GO:0042254	ribosome biogenesis
GO:0042273	ribosomal large subunit biogenesis
GO:0051726	regulation of cell cycle

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus
GO:0005829	cytosol
GO:0016020	membrane
GO:0030687	preribosome, large subunit precursor
GO:0070545	PeBoW complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ipx, PDBe:8ipx, PDBj:8ipx
PDBsum	8ipx
PubMed	37491604
UniProt	O00541\|PESC_HUMAN Pescadillo homolog (Gene Name=PES1)

[Back to BioLiP]