Structure of PDB 8bh6 Chain q

Receptor sequence
>8bh6q (length=86) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
SERNDRKVYVGKVVSDKMDKTITVLVETYKTHKLYGKRVKYSKKYKTHDE
NNSAKLGDIVKIQETRPLSATKRFRLVEIVEESVII
3D structure
PDB8bh6 Ribosome maturation factor P (RimP) from Staphylococcus aureus
Chainq
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q S2 R4 N5 R7 K8 K18 M19 D20 K21 Y30 K31 L35 Y36 Y42 S43 K44 K45 Y46 K47 Q64 T66 R67 P68 L69 S70 A71 K73 R74 R76 S1 R3 N4 R6 K7 K17 M18 D19 K20 Y29 K30 L34 Y35 Y41 S42 K43 K44 Y45 K46 Q63 T65 R66 P67 L68 S69 A70 K72 R73 R75
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bh6, PDBe:8bh6, PDBj:8bh6
PDBsum8bh6
PubMed
UniProtQ2FW15|RS17_STAA8 Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]