Structure of PDB 7uqz Chain q

Receptor sequence
>7uqzq (length=156) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
KKSTTSWSTASVRPSTLDIEPIAVKEFTEIPHAGKSYNPNNKAWSELINK
EYKEEKAREDERIALEKYKERIRHLMETLKKHKLGTKYSVIDERLEIKFS
DELSDSLRKLKPEGNLLYDTVRKLQSSGKVETRVPVRKGRKYKQKITEKW
THKDFK
3D structure
PDB7uqz rRNA methylation by Spb1 regulates the GTPase activity of Nog2 during 60S ribosomal subunit assembly.
Chainq
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q K380 R432 V433 P434 V435 R436 K437 G438 R439 K440 Y441 K442 I445 W449 K452 K81 R133 V134 P135 V136 R137 K138 G139 R140 K141 Y142 K143 I146 W150 K153
BS02 rna q K192 S193 T195 S196 S198 T199 A200 V202 T206 K448 W449 K2 S3 T5 S6 S8 T9 A10 V12 T16 K149 W150
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0000055 ribosomal large subunit export from nucleus
GO:0000460 maturation of 5.8S rRNA
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0000176 nuclear exosome (RNase complex)
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uqz, PDBe:7uqz, PDBj:7uqz
PDBsum7uqz
PubMed36864048
UniProtQ12080|NOP53_YEAST Ribosome biogenesis protein NOP53 (Gene Name=NOP53)

[Back to BioLiP]