Structure of PDB 7qwq Chain q

Receptor sequence
>7qwqq (length=105) Species: 9606 (Homo sapiens) [Search protein sequence]
DRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFL
EKNKMYSREWNRDVQYRGRVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMI
PKLKT
3D structure
PDB7qwq Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.
Chainq
Resolution2.83 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q F15 I16 C17 Y19 Y22 T28 I29 R33 R34 P36 I37 M67 Y68 S69 R70 W72 R74 R81 R101 K102 F3 I4 C5 Y7 Y10 T16 I17 R21 R22 P24 I25 M55 Y56 S57 R58 W60 R62 R69 R89 K90
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008312 7S RNA binding
GO:0043022 ribosome binding
Biological Process
GO:0006613 cotranslational protein targeting to membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
GO:0006617 SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005786 signal recognition particle, endoplasmic reticulum targeting
GO:0005829 cytosol
GO:0016604 nuclear body
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qwq, PDBe:7qwq, PDBj:7qwq
PDBsum7qwq
PubMed35201867
UniProtP09132|SRP19_HUMAN Signal recognition particle 19 kDa protein (Gene Name=SRP19)

[Back to BioLiP]