Structure of PDB 7qgg Chain q

Receptor sequence
>7qggq (length=91) Species: 10116 (Rattus norvegicus) [Search protein sequence]
AKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRA
VGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLEELKDQ
3D structure
PDB7qgg Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.
Chainq
Resolution2.86 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q A2 R4 T5 K6 K7 V8 G9 I10 K13 Y14 G15 T16 R17 Y18 G19 A20 S21 R23 H34 F41 C42 K44 K46 R49 R50 A51 G58 M61 W69 A1 R3 T4 K5 K6 V7 G8 I9 K12 Y13 G14 T15 R16 Y17 G18 A19 S20 R22 H33 F40 C41 K43 K45 R48 R49 A50 G57 M60 W68
BS02 ZN q C39 C42 C57 C38 C41 C56
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qgg, PDBe:7qgg, PDBj:7qgg
PDBsum7qgg
PubMed36038000
UniProtA0A6J2LF66

[Back to BioLiP]