Structure of PDB 7q0p Chain q

Receptor sequence

>7q0pq (length=190) Species: 237561 (Candida albicans SC5314) [Search protein sequence]

MKYIQTDQILDIPEGVTVDIKARVVKVTGPRGELTKDLKHIDVTFNKINN
RAIKITVHNGDRKHVAALRTVKSLIANLITGVTKGYKYKMRFVYAHFPIN
VNIIKKDGQDYVEIRNFLGEKRVREVKIHEGVTMEISSTQKDELIVSGNS
LEAVSQNAADIQQICRVRNKDIRKFLDGIYVSERGTIVEE

3D structure

PDB

7q0p E-site drug specificity of the human pathogen Candida albicans ribosome.

Chain

Resolution

2.77 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	q	M1 R23 H40 D42 V43 T44 H58 R62 K63 A66 R69 T70 S73 L74 N77 H96 F97 E120 K121 R122 S155 Q156 A159 Q163 R168 K170 D171 R173 K174 F175	M1 R23 H40 D42 V43 T44 H58 R62 K63 A66 R69 T70 S73 L74 N77 H96 F97 E120 K121 R122 S155 Q156 A159 Q163 R168 K170 D171 R173 K174 F175

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q0p, PDBe:7q0p, PDBj:7q0p
PDBsum	7q0p
PubMed	35613268
UniProt	Q5AEN2\|RL9B_CANAL Large ribosomal subunit protein uL6 (Gene Name=RPL9B)

[Back to BioLiP]