Structure of PDB 7q0f Chain q

Receptor sequence
>7q0fq (length=190) Species: 237561 (Candida albicans SC5314) [Search protein sequence]
MKYIQTDQILDIPEGVTVDIKARVVKVTGPRGELTKDLKHIDVTFNKINN
RAIKITVHNGDRKHVAALRTVKSLIANLITGVTKGYKYKMRFVYAHFPIN
VNIIKKDGQDYVEIRNFLGEKRVREVKIHEGVTMEISSTQKDELIVSGNS
LEAVSQNAADIQQICRVRNKDIRKFLDGIYVSERGTIVEE
3D structure
PDB7q0f E-site drug specificity of the human pathogen Candida albicans ribosome.
Chainq
Resolution2.64 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q R23 K39 H40 D42 V43 H58 R62 A66 R69 T70 S73 L74 N77 H96 F97 K121 R122 E152 S155 Q156 A159 Q163 R168 K170 D171 R173 K174 F175 R23 K39 H40 D42 V43 H58 R62 A66 R69 T70 S73 L74 N77 H96 F97 K121 R122 E152 S155 Q156 A159 Q163 R168 K170 D171 R173 K174 F175
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q0f, PDBe:7q0f, PDBj:7q0f
PDBsum7q0f
PubMed35613268
UniProtQ5AEN2|RL9B_CANAL Large ribosomal subunit protein uL6 (Gene Name=RPL9B)

[Back to BioLiP]