Structure of PDB 7pkt Chain q

Receptor sequence

>7pktq (length=161) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

PRNWMWYDADDEREERRKERQRLAWAMGPGGGEEVGAAHLMDVPQSMKKM
QRIVKLVRGLPYPDAVAQCSLVPHKAARYMLQALEAAHADATEVKGLDAE
RLVVGTVFVTRGAYEPGISYHSKGRPGSKTFHRSHIRVVLNQAAERPAPF
ARIVAPLMSRR

3D structure

PDB

7pkt How to build a ribosome from RNA fragments in Chlamydomonas mitochondria.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	q	R206 Q214 A217 W218 M220 M240 R251 F301 V302 T303 R304 H328 R330	R13 Q21 A24 W25 M27 M47 R58 F108 V109 T110 R111 H135 R137
BS02	rna	q	S315 K316	S122 K123
BS03	rna	q	S239 K241 R304 H325	S46 K48 R111 H132
BS04	rna	q	Q238 K242 R245 H267 K268 Y313 H314 G317 R318 S321 K322	Q45 K49 R52 H74 K75 Y120 H121 G124 R125 S128 K129
BS05	rna	q	R345 S352 R353 R354	R152 S159 R160 R161

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7pkt, PDBe:7pkt, PDBj:7pkt
PDBsum	7pkt
PubMed	34887394
UniProt	A0A2K3DSG6

[Back to BioLiP]