Structure of PDB 7paq Chain q

Receptor sequence
>7paqq (length=99) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
MHAIVVCGSKQYLVHENDTFFVEKLEAPVGKEIQLDKVLMLDEKIGAPYL
EKARVVCVVEKHGLQRKVNVIKHISQKHHLKKYGHRQPYTKLKVVRFVH
3D structure
PDB7paq Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainq
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q G8 S9 K10 F21 E23 K24 L25 Q65 K67 V68 K72 H73 S75 Q76 K77 H78 H79 K81 K82 Y83 G84 H85 R86 Q87 Y89 G8 S9 K10 F21 E23 K24 L25 Q65 K67 V68 K72 H73 S75 Q76 K77 H78 H79 K81 K82 Y83 G84 H85 R86 Q87 Y89
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7paq, PDBe:7paq, PDBj:7paq
PDBsum7paq
PubMed36171285
UniProtP78026|RL21_MYCPN Large ribosomal subunit protein bL21 (Gene Name=rplU)

[Back to BioLiP]