Structure of PDB 7p7u Chain q

Receptor sequence
>7p7uq (length=87) Species: 1351 (Enterococcus faecalis) [Search protein sequence]
AVKIRLKRMGSKKSPFYRIVVADSRSPRDGRFIETVGTYNPLKDPAEVVL
KEDLVLDWLSKGAQPSDTVRNILSKEGVMKKHHEAKN
3D structure
PDB7p7u Structural basis for PoxtA-mediated resistance to phenicol and oxazolidinone antibiotics.
Chainq
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna q A2 V3 K4 R6 L7 R9 M10 G11 S12 K13 K14 F17 Y18 R19 D24 S25 R26 R29 G31 R32 I34 L43 Q65 S67 T69 N72 S75 K76 M80 K81 H84 A1 V2 K3 R5 L6 R8 M9 G10 S11 K12 K13 F16 Y17 R18 D23 S24 R25 R28 G30 R31 I33 L42 Q64 S66 T68 N71 S74 K75 M79 K80 H83
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7p7u, PDBe:7p7u, PDBj:7p7u
PDBsum7p7u
PubMed35387982
UniProtA0A1B4XP69

[Back to BioLiP]